Insulin-Like Growth Factor-1

Insulin-Like Growth Factor-1
Производитель: Peptide Sciences
Модель: IGF-1 (4-70) 1mg
Наличие: В наличии
Цена: 481грн.
Количество:     - или -   В заметки
В сравнения

Инсулиноподобный фактор роста IGF-1 DES пептид влияющий на рост и гиперплазию мышц, вырабатывается мышцами и печенью при взаимодействие с Соматотропным гормоном роста. IGF-1 DES состоит  из единой полипептидной цепи, содержит в себе 67 аминокислот, имеет молекулярную массу 7,372 Da. 

Insulin-Like Growth Factor-1 DES (1-3) был создан на основе стандартной молекулы IGF-1 состоящей из 70 аминокислот.  IGF-1 DES (1-3) представляет собой расщепленный вид ИФР-1 и содержит аминокислоты 4-70. Аминокислоты с порядковым номером 1,2,3 из молекулы  IGF-1 были удалены. Результат лабораторных исследований показал, что при равных дозах DES  IGF-1 (4-70), в десять раз оказался более мощным в стимулировании гипертрофии и пролиферации клеток (разрастание ткани и размножения клеток за счет деления), чем ИФР-1.  Пост-трансляционная модификация являются завершающим этапом биосинтеза в процессе генерации созревших IGF-1.

Название: Insulin-Like Growth Factor-1 DES (1-3), IGF-1 Des(1-3), Des1-3, Des 1-3, Des (1-3), IGF-1 (4-70), ИФР-1 Дес,  ИФР-1 (1-3), ИФР-1 (4-70), IGF-1 DES (1-3)
Аминокислотная последовательность: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA 
Молярная масса: 7,372 Da 
 

Эффекты от применения DES  IGF-1 (4-70) во многом похожи с эффектами гормона роста, сепарация мышц, сжигание лишнего жира, рост мышечных тканей, и много других полезных эффектов для людей которые хотят быть здоровыми и молодыми.

Кроме IGF-1 DES , Инсулиноподобный фактор роста IGF-1 имеет несколько изоформ, инновационная разработка на базе  ИФР-1 Механический фактор роста (MGF) и модифицированный IGF1 LR3 с более длинной аминокислотной цепью. Отличительной особенностью ИФР-1 Дес является способность одновременно включить в работу больше рецепторов, при этом задействуются также рецепторы имеющие частичные повреждения от воздействия молочной кислоты!

Инсулиноподобный фактор роста 1 DES  вводится в организм с помощью инъекции, ряд атлетов обкалывают целевые мышцы (научного подтверждения эффективности ставить инъекцию в отстающие мышцы нет). Снижение эффективности или привыкание к ИФР-1 DES наступает через 3 недели, по этому длительность курса более 4 недель не имеет особого смысла. Разовая дозировка составляет от 0,05 до 0,15 мг, в течение дня можно ставить несколько инъекций. Производительность ИФР-1 в организме напрямую зависит от воздействия тренировок с отягощениями, по этому лучше всего ставить инъекцию перед началом или окончанием тренировки

Написать отзыв

Ваше Имя:


Ваш отзыв: Внимание: HTML не поддерживается! Используйте обычный текст.

Оценка: Плохо           Хорошо

Введите код, указанный на картинке: